LV657_HUMAN P01721
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01721
Recommended name:Immunoglobulin lambda variable 6-57
EC number:
Alternative names:(Ig lambda chain V-VI region AR) (Ig lambda chain V-VI region EB4) (Ig lambda chain V-VI region NIG-48) (Ig lambda chain V-VI region SUT) (Ig lambda chain V-VI region WLT)
Cleaved into:
GeneID:
Gene names (primary ):IGLV6-57
Gene names (synonym ):
Gene names (ORF ):
Length:117
Mass:12566
Sequence:MAWAPLLLTLLAHCTGSWANFMLTQPHSVSESPGKTVTISCTGSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSN
Tissue specificity:
Induction:
Developmental stage:
Protein families: