KRA71_HUMAN   Q8IUC3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IUC3

Recommended name:Keratin-associated protein 7-1

EC number:

Alternative names:(High tyrosine-glycine keratin-associated protein 7.1)

Cleaved into:

GeneID:337878

Gene names  (primary ):KRTAP7-1

Gene names  (synonym ):KAP7.1 KRTAP7.1

Gene names  (ORF ):

Length:87

Mass:9288

Sequence:MTRYFCCGSYFPGYPIYGTNFHGTFRATPLNCVVPLGSPLNYGCGCNGYSSLGYSFGGSNINNLGGCYGGSFYRPWGSGSGFGYSTY

Tissue specificity:Expressed in the upper portion of the hair cortex.

Induction:

Developmental stage:

Protein families:KRTAP type 7 family


   💬 WhatsApp