KR131_HUMAN   Q8IUC0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IUC0

Recommended name:Keratin-associated protein 13-1

EC number:

Alternative names:(High sulfur keratin-associated protein 13.1)

Cleaved into:

GeneID:140258

Gene names  (primary ):KRTAP13-1

Gene names  (synonym ):KAP13.1 KRTAP13.1

Gene names  (ORF ):

Length:172

Mass:18320

Sequence:MSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSPCQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYSVGCGSSGFRSLGYGGCGFPSLGYGVGFCRPTYLASRSCQSSCYRPTCGSGFYY

Tissue specificity:Weak expression seen in the late matrix and entire cortex area of the hair follicle. {ECO:0000269|PubMed:12359730}.

Induction:

Developmental stage:

Protein families:PMG family


   💬 WhatsApp