CHP2_HUMAN   O43745


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43745

Recommended name:Calcineurin B homologous protein 2

EC number:

Alternative names:(Hepatocellular carcinoma-associated antigen 520)

Cleaved into:

GeneID:63928

Gene names  (primary ):CHP2

Gene names  (synonym ):HCA520

Gene names  (ORF ):

Length:196

Mass:22452

Sequence:MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK

Tissue specificity:Expressed in malignantly transformed cells but not detected in normal tissues. {ECO:0000269|PubMed:12097419, ECO:0000269|PubMed:12226101}.

Induction:

Developmental stage:

Protein families:Calcineurin regulatory subunit family, CHP subfamily