GPX6_HUMAN   P59796


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P59796

Recommended name:Glutathione peroxidase 6

EC number:EC:1.11.1.9

Alternative names:(GPx-6) (GSHPx-6)

Cleaved into:

GeneID:257202

Gene names  (primary ):GPX6

Gene names  (synonym ):

Gene names  (ORF ):

Length:221

Mass:24971

Sequence:MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYGALTLNGEEYIQFKQFAGKHVLFVNVAAYUGLAAQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLKYVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIRWNFEKFLVGPDGVPVMHWFHQAPVSTVKSDILEYLKQFNTH

Tissue specificity:Expressed in olfactory epithelium and embryos. {ECO:0000269|PubMed:12775843}.

Induction:

Developmental stage:

Protein families:Glutathione peroxidase family


   💬 WhatsApp