SOM2_HUMAN   P01242


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01242

Recommended name:Growth hormone variant

EC number:

Alternative names:(GH-V) (Growth hormone 2) (Placenta-specific growth hormone)

Cleaved into:

GeneID:2689

Gene names  (primary ):GH2

Gene names  (synonym ):

Gene names  (ORF ):

Length:217

Mass:25000

Sequence:MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Tissue specificity:Expressed in the placenta.

Induction:

Developmental stage:

Protein families:Somatotropin/prolactin family


   💬 WhatsApp