FONG_HUMAN   E5RQL4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:E5RQL4

Recommended name:Formiminotransferase N-terminal subdomain-containing protein

EC number:

Alternative names:(Formiminotransferase-cyclodeaminase N-terminal-like protein)

Cleaved into:

GeneID:

Gene names  (primary ):FTCDNL1

Gene names  (synonym ):FONG

Gene names  (ORF ):

Length:147

Mass:16268

Sequence:MSSSRVGLRLAACLLNVSEAGRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYKRSVITIATSVDKLGLAEDLVLHVPGCSVFLFGEADLPEKRSLVQRRKQLGWFTRRDFSALQPDLGAAPSQRCGLTGSEHGFCFALFFFFF

Tissue specificity:Widely expressed with highest levels in liver and skeletal muscle, and moderate levels in kidney, bone and pancreas. {ECO:0000269|PubMed:21573128}.

Induction:

Developmental stage:

Protein families:Formiminotransferase family


   💬 WhatsApp