STYL1_HUMAN   Q9Y6J8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y6J8

Recommended name:Serine/threonine/tyrosine-interacting-like protein 1

EC number:

Alternative names:(Dual specificity phosphatase inhibitor MK-STYX) (Dual specificity protein phosphatase 24) (Inactive dual specificity protein phosphatase MK-STYX) (Map kinase phosphatase-like protein MK-STYX)

Cleaved into:

GeneID:51657

Gene names  (primary ):STYXL1

Gene names  (synonym ):DUSP24 MKSTYX

Gene names  (ORF ):

Length:313

Mass:35818

Sequence:MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY

Tissue specificity:

Induction:

Developmental stage:

Protein families:Protein-tyrosine phosphatase family, Non-receptor class subfamily


   💬 WhatsApp