NC2A_HUMAN   Q14919


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14919

Recommended name:Dr1-associated corepressor

EC number:

Alternative names:(Dr1-associated protein 1) (Negative cofactor 2-alpha) (NC2-alpha)

Cleaved into:

GeneID:10589

Gene names  (primary ):DRAP1

Gene names  (synonym ):

Gene names  (ORF ):

Length:205

Mass:22350

Sequence:MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS

Tissue specificity:Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney. {ECO:0000269|PubMed:8608938, ECO:0000269|PubMed:8670811}.

Induction:

Developmental stage:

Protein families:NC2 alpha/DRAP1 family


   💬 WhatsApp