CX6A2_HUMAN Q02221
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q02221
Recommended name：Cytochrome c oxidase subunit 6A2, mitochondrial
EC number：
Alternative names：(Cytochrome c oxidase polypeptide VIa-heart) (COXVIAH) (Cytochrome c oxidase subunit VIA-muscle) (COX VIa-M)
Cleaved into：
GeneID：1339
Gene names (primary )：COX6A2
Gene names (synonym )：COX6A COX6AH
Gene names (ORF )：
Length：97
Mass：10815
Sequence：MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
Tissue specificity：Expressed specifically in heart and muscle. {ECO:0000269|PubMed:1327966}.
Induction：
Developmental stage：
Protein families：Cytochrome c oxidase subunit 6A family