CCN5_HUMAN   O76076


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O76076

Recommended name:CCN family member 5

EC number:

Alternative names:(Connective tissue growth factor-like protein) (CTGF-L) (Connective tissue growth factor-related protein 58) (WNT1-inducible-signaling pathway protein 2) (WISP-2)

Cleaved into:

GeneID:8839

Gene names  (primary ):CCN5

Gene names  (synonym ):CT58 CTGFL WISP2

Gene names  (ORF ):UNQ228/PRO261

Length:250

Mass:26825

Sequence:MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Tissue specificity:Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.

Induction:

Developmental stage:

Protein families:CCN family


   💬 WhatsApp