BAGE2_HUMAN   Q86Y30


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86Y30

Recommended name:B melanoma antigen 2

EC number:

Alternative names:(Cancer/testis antigen 2.2) (CT2.2)

Cleaved into:

GeneID:

Gene names  (primary ):BAGE2

Gene names  (synonym ):

Gene names  (ORF ):

Length:109

Mass:12114

Sequence:MAAGVVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTAFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS

Tissue specificity:Not expressed in normal tissues except in testis. Expressed in 22% of melanomas, in bladder and lung carcinomas.

Induction:

Developmental stage:

Protein families:BAGE family


   💬 WhatsApp