CK2N2_HUMAN Q96S95
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96S95
Recommended name:Calcium/calmodulin-dependent protein kinase II inhibitor 2
EC number:
Alternative names:(CaM-KII inhibitory protein) (CaM-KIIN)
Cleaved into:
GeneID:94032
Gene names (primary ):CAMK2N2
Gene names (synonym ):
Gene names (ORF ):
Length:79
Mass:8658
Sequence:MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV
Tissue specificity:Expressed in cell lines including hemopoietic cell lines and some tumor cell lines. Highly Expressed in stimulated dendritic cell (DC) and weakly expressed in unstimulated mature and immature DC. Highly expressed in kidney, liver, in cell lines HeLaS3, lymphoblastic leukemia MOLT-4, and Burkitt's lymphoma Raji. Moderately expressed in heart, skeletal muscle, placenta, and chronic myelogenous leukemia K-562 cells. Weakly expressed in small intestine, colorectal adenocarcinoma SW480, and lung carcinoma A-549 cells. {ECO:0000269|PubMed:11444830}.
Induction:
Developmental stage:
Protein families:CAMK2N family