RAMP1_HUMAN O60894
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O60894
Recommended name：Receptor activity-modifying protein 1
EC number：
Alternative names：(Calcitonin-receptor-like receptor activity-modifying protein 1) (CRLR activity-modifying protein 1)
Cleaved into：
GeneID：10267
Gene names (primary )：RAMP1
Gene names (synonym )：
Gene names (ORF )：
Length：148
Mass：16988
Sequence：MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Tissue specificity：Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract. {ECO:0000269|PubMed:9620797}.
Induction：
Developmental stage：
Protein families：RAMP family