C1QL4_HUMAN Q86Z23
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86Z23
Recommended name：Complement C1q-like protein 4
EC number：
Alternative names：(C1q and tumor necrosis factor-related protein 11) (C1q/TNF-related protein 11)
Cleaved into：
GeneID：338761
Gene names (primary )：C1QL4
Gene names (synonym )：CTRP11
Gene names (ORF )：
Length：238
Mass：24909
Sequence：MVLLLLVAIPLLVHSSRGPAHYEMLGRCRMVCDPHGPRGPGPDGAPASVPPFPPGAKGEVGRRGKAGLRGPPGPPGPRGPPGEPGRPGPPGPPGPGPGGVAPAAGYVPRIAFYAGLRRPHEGYEVLRFDDVVTNVGNAYEAASGKFTCPMPGVYFFAYHVLMRGGDGTSMWADLMKNGQVRASAIAQDADQNYDYASNSVILHLDVGDEVFIKLDGGKVHGGNTNKYSTFSGFIIYPD
Tissue specificity：Highest expression levels in testis and adipose tissue, lower levels in skeletal muscle and kidney. {ECO:0000269|PubMed:23449976}.
Induction：
Developmental stage：
Protein families：