BORG2_HUMAN   Q9UKI2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UKI2

Recommended name:Cdc42 effector protein 3

EC number:

Alternative names:(Binder of Rho GTPases 2) (MSE55-related Cdc42-binding protein)

Cleaved into:

GeneID:10602

Gene names  (primary ):CDC42EP3

Gene names  (synonym ):BORG2 CEP3

Gene names  (ORF ):

Length:254

Mass:27678

Sequence:MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK

Tissue specificity:Highly expressed in the heart and weakly in the brain. {ECO:0000269|PubMed:10490598}.

Induction:

Developmental stage:

Protein families:BORG/CEP family


   💬 WhatsApp