ARL11_HUMAN   Q969Q4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q969Q4

Recommended name:ADP-ribosylation factor-like protein 11

EC number:

Alternative names:(ADP-ribosylation factor-like tumor suppressor protein 1)

Cleaved into:

GeneID:115761

Gene names  (primary ):ARL11

Gene names  (synonym ):ARLTS1

Gene names  (ORF ):

Length:196

Mass:21391

Sequence:MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS

Tissue specificity:Expressed in lung and leukocytes. {ECO:0000269|PubMed:15843669}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Arf family


   💬 WhatsApp