ZDHC6_HUMAN   Q9H6R6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H6R6

Recommended name:Palmitoyltransferase ZDHHC6

EC number:EC:2.3.1.225

Alternative names:(Stearoyltransferase ZDHHC6) (Transmembrane protein H4) (Zinc finger DHHC domain-containing protein 6) (DHHC-6) (Zinc finger protein 376)

Cleaved into:

GeneID:64429

Gene names  (primary ):ZDHHC6

Gene names  (synonym ):ZNF376

Gene names  (ORF ):

Length:413

Mass:47663

Sequence:MGTFCSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILYNYFNAMFVGPGFVPLGWKPEISQDTMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAFATTLFALGLALGTTIAVGMLFFIQMKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVFTWSGVPEGDGLEWPVREGCHQYSLTIEQLKQKADKRVRSVRYKVIEDYSGACCPLNKGIKTFFTSPCTEEPRIQLQKGEFILATRGLRYWLYGDKILDDSFIEGVSRIRGWFPRKCVEKCPCDAETDQAPEGEKKNR

Tissue specificity:

Induction:

Developmental stage:

Protein families:DHHC palmitoyltransferase family


   💬 WhatsApp