MARH9_HUMAN   Q86YJ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86YJ5

Recommended name:E3 ubiquitin-protein ligase MARCHF9

EC number:EC:2.3.2.27

Alternative names:(Membrane-associated RING finger protein 9) (Membrane-associated RING-CH protein IX) (MARCH-IX) (RING finger protein 179) (RING-type E3 ubiquitin transferase MARCHF9)

Cleaved into:

GeneID:92979

Gene names  (primary ):MARCHF9

Gene names  (synonym ):MARCH9 RNF179

Gene names  (ORF ):

Length:346

Mass:37772

Sequence:MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTRDGDGDEEEYYGSEPRARGLAGDKEPRAGPLPPPAPPLPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:14722266}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp