GSTA4_HUMAN   O15217


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O15217

Recommended name:Glutathione S-transferase A4

EC number:EC:2.5.1.18

Alternative names:(GST class-alpha member 4) (Glutathione S-transferase A4-4)

Cleaved into:

GeneID:2941

Gene names  (primary ):GSTA4

Gene names  (synonym ):

Gene names  (ORF ):

Length:222

Mass:25704

Sequence:MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Tissue specificity:Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.

Induction:

Developmental stage:

Protein families:GST superfamily, Alpha family


   💬 WhatsApp