FACE2_HUMAN   Q9Y256


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y256

Recommended name:CAAX prenyl protease 2

EC number:EC:3.4.22.-

Alternative names:(Farnesylated proteins-converting enzyme 2) (FACE-2) (Prenyl protein-specific endoprotease 2) (RCE1 homolog) (hRCE1)

Cleaved into:

GeneID:9986

Gene names  (primary ):RCE1

Gene names  (synonym ):FACE2 RCE1A RCE1B

Gene names  (ORF ):

Length:329

Mass:35833

Sequence:MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:10085068}.

Induction:

Developmental stage:

Protein families:Peptidase U48 family


   💬 WhatsApp