SENP8_HUMAN   Q96LD8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96LD8

Recommended name:Sentrin-specific protease 8

EC number:EC:3.4.22.-

Alternative names:(Deneddylase-1) (NEDD8-specific protease 1) (Protease, cysteine 2) (Sentrin/SUMO-specific protease SENP8)

Cleaved into:

GeneID:123228

Gene names  (primary ):SENP8

Gene names  (synonym ):DEN1 NEDP1 PRSC2

Gene names  (ORF ):FKSG8

Length:212

Mass:24107

Sequence:MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

Tissue specificity:Broadly expressed, with highest levels in kidney and pancreas. {ECO:0000269|PubMed:12730221}.

Induction:

Developmental stage:

Protein families:Peptidase C48 family


   💬 WhatsApp