DUS22_HUMAN Q9NRW4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NRW4
Recommended name：Dual specificity protein phosphatase 22
EC number：EC:3.1.3.16
Alternative names：(JNK-stimulatory phosphatase-1) (JSP-1) (Low molecular weight dual specificity phosphatase 2) (LMW-DSP2) (Mitogen-activated protein kinase phosphatase x) (MAP kinase phosphatase x) (MKP-x)
Cleaved into：
GeneID：56940
Gene names (primary )：DUSP22
Gene names (synonym )：JSP1 LMWDSP2 MKPX
Gene names (ORF )：
Length：184
Mass：20910
Sequence：MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Tissue specificity：Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas. {ECO:0000269|PubMed:11717427}.
Induction：
Developmental stage：
Protein families：Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily