NKG7_HUMAN Q16617
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16617
Recommended name：Protein NKG7
EC number：
Alternative names：(G-CSF-induced gene 1 protein) (GIG-1 protein) (Granule membrane protein of 17 kDa) (GMP-17) (Natural killer cell protein 7) (p15-TIA-1)
Cleaved into：
GeneID：4818
Gene names (primary )：NKG7
Gene names (synonym )：GIG1
Gene names (ORF )：
Length：165
Mass：17665
Sequence：MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQTFSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL
Tissue specificity：Expressed in activated T-cells, in kidney, liver, lung and pancreas. Not expressed in brain, heart, or skeletal muscle. Expressed at high levels in TCR gamma delta-expressing CTL clones, and in some TCR alpha beta-expressing CTL clones (both CD4+ and CD8+), but is not expressed in other TCR alpha beta-expressing CTL clones and in cell lines representing B-cells, monocytes, and myeloid cells.
Induction：By CSF3/G-CSF.
Developmental stage：
Protein families：PMP-22/EMP/MP20 family