ILRUN_HUMAN Q9H6K1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H6K1
Recommended name：Protein ILRUN
EC number：
Alternative names：(Inflammation and lipid regulator with UBA-like and NBR1-like domains protein)
Cleaved into：
GeneID：64771
Gene names (primary )：ILRUN
Gene names (synonym )：C6orf106
Gene names (ORF )：
Length：298
Mass：32872
Sequence：MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS
Tissue specificity：Expressed in lung (at protein level). {ECO:0000269|PubMed:25736925}.
Induction：Expression is icreased in presence of dsRNA such as poly(I:C). {ECO:0000269|PubMed:29802199}.
Developmental stage：
Protein families：