SPTSB_HUMAN   Q8NFR3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NFR3

Recommended name:Serine palmitoyltransferase small subunit B

EC number:

Alternative names:(Protein ADMP) (Small subunit of serine palmitoyltransferase B) (ssSPTb)

Cleaved into:

GeneID:165679

Gene names  (primary ):SPTSSB

Gene names  (synonym ):ADMP C3orf57 SSSPTB

Gene names  (ORF ):

Length:76

Mass:9198

Sequence:MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN

Tissue specificity:Expression is seen predominantly in the prostate epithelium with weaker expression in the fibroblasts and endothelial cells. {ECO:0000269|PubMed:15777716}.

Induction:Expression is suppressed by androgens in the androgen-sensitive LNCaP cell line. {ECO:0000269|PubMed:15777716}.

Developmental stage:

Protein families:SPTSS family, SPTSSB subfamily


   💬 WhatsApp