TNF18_HUMAN Q9UNG2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UNG2
Recommended name：Tumor necrosis factor ligand superfamily member 18
EC number：
Alternative names：(Activation-inducible TNF-related ligand) (AITRL) (Glucocorticoid-induced TNF-related ligand) (hGITRL)
Cleaved into：
GeneID：8995
Gene names (primary )：TNFSF18
Gene names (synonym )：AITRL GITRL TL6
Gene names (ORF )：UNQ149/PRO175
Length：199
Mass：22724
Sequence：MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Tissue specificity：Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
Induction：Up-regulated after stimulation by bacterial lipopolysaccharides (LPS).
Developmental stage：
Protein families：Tumor necrosis factor family