SAMN1_HUMAN Q9NSI8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NSI8
Recommended name:SAM domain-containing protein SAMSN-1
EC number:
Alternative names:(Hematopoietic adaptor containing SH3 and SAM domains 1) (Nash1) (SAM domain, SH3 domain and nuclear localization signals protein 1) (SH3-SAM adaptor protein)
Cleaved into:
GeneID:64092
Gene names (primary ):SAMSN1
Gene names (synonym ):HACS1
Gene names (ORF ):
Length:373
Mass:41708
Sequence:MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPSD
Tissue specificity:Detected in peripheral blood B-cells (at protein level). Detected in spleen, liver and peripheral blood. {ECO:0000269|PubMed:11594764, ECO:0000269|PubMed:15381729}.
Induction:Up-regulated in peripheral blood B-cells by IL4, IL13 and by CD40 stimulation. {ECO:0000269|PubMed:15381729}.
Developmental stage:
Protein families: