DX39A_HUMAN O00148
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O00148
Recommended name：ATP-dependent RNA helicase DDX39A
EC number：EC:3.6.4.13
Alternative names：(DEAD box protein 39) (Nuclear RNA helicase URH49)
Cleaved into：
GeneID：10212
Gene names (primary )：DDX39A
Gene names (synonym )：DDX39
Gene names (ORF )：
Length：427
Mass：49130
Sequence：MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDISTYIEQSR
Tissue specificity：Detected in testis, and at lower levels in brain, kidney, lung, thymus, spleen and salivary gland. {ECO:0000269|PubMed:15047853}.
Induction：Up-regulated in proliferating cells. Present at low levels in quiescent cells. {ECO:0000269|PubMed:15047853}.
Developmental stage：
Protein families：DEAD box helicase family, DECD subfamily