NCYM_HUMAN   P40205


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P40205

Recommended name:N-cym protein

EC number:

Alternative names:(N-myc opposite strand)

Cleaved into:

GeneID:

Gene names  (primary ):MYCNOS

Gene names  (synonym ):CYMN NCYM

Gene names  (ORF ):

Length:109

Mass:11733

Sequence:MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPALTACCAAEREANVEQGLAGRLLLCNYERRVVRRCKIAGRGRAPLGTRPLDVSSFKLKEEGRPPCLKINK

Tissue specificity:Expressed in the neuronal cells of the cerebrum and cerebellum, spermatocytes of the testis, pancreatic cells and also the heart. Expressed in both primary and metastatic neuroblastomas and in thyroid tumors (at protein level). Expression is associated with poor prognosis in neuroblastoma. Expressed in the fetal brain, lung, liver and kidney at varying low levels. {ECO:0000269|PubMed:1419902, ECO:0000269|PubMed:24391509}.

Induction:

Developmental stage:Expressed during fetal development, as well as in tumor cell lines containing amplified MYCN loci, where it is expressed at very high levels.

Protein families:


   💬 WhatsApp