SNAPN_HUMAN   O95295


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O95295

Recommended name:SNARE-associated protein Snapin

EC number:

Alternative names:(Biogenesis of lysosome-related organelles complex 1 subunit 7) (BLOC-1 subunit 7) (Synaptosomal-associated protein 25-binding protein) (SNAP-associated protein)

Cleaved into:

GeneID:23557

Gene names  (primary ):SNAPIN

Gene names  (synonym ):BLOC1S7 SNAP25BP SNAPAP

Gene names  (ORF ):

Length:136

Mass:14874

Sequence:MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK

Tissue specificity:Expressed in male germ cells of adult testis (at protein level). {ECO:0000269|PubMed:19168546}.

Induction:

Developmental stage:Expressed in germ cells of 22-week prenatal testis. {ECO:0000269|PubMed:19168546}.

Protein families:SNAPIN family


   💬 WhatsApp