GNT2A_HUMAN   Q8N0V5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N0V5

Recommended name:N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase

EC number:EC:2.4.1.150

Alternative names:(N-acetylglucosaminyltransferase) (I-branching enzyme) (IGNT)

Cleaved into:

GeneID:2651

Gene names  (primary ):GCNT2

Gene names  (synonym ):GCNT5 II NACGT1

Gene names  (ORF ):

Length:402

Mass:45873

Sequence:MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYPTENALKTTLDEATCYEYMVRSHYVTETLSEEEAGFPLAYTVTIHKDFGTFERLFRAIYMPQNVYCVHLDQKATDAFKGAVKQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF

Tissue specificity:Isoform B is expressed in lens epithelium cells. Isoform C is expressed in reticulocytes. {ECO:0000269|PubMed:12424189, ECO:0000269|PubMed:12468428}.

Induction:

Developmental stage:Expression of isoform B increases dramatically during development and oncogenesis. {ECO:0000269|PubMed:7579796}.

Protein families:Glycosyltransferase 14 family


   💬 WhatsApp