IFNE_HUMAN Q86WN2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86WN2
Recommended name：Interferon epsilon
EC number：
Alternative names：(IFN-epsilon) (Interferon epsilon-1)
Cleaved into：
GeneID：338376
Gene names (primary )：IFNE
Gene names (synonym )：IFNE1
Gene names (ORF )：UNQ360/PRO655
Length：208
Mass：24414
Sequence：MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Tissue specificity：Endometrium-specific. {ECO:0000269|PubMed:23449591}.
Induction：By estrogens. {ECO:0000305|PubMed:23449591}.
Developmental stage：Highly expressed in endometrial epithelial cells in proliferative phase of the menstrual cycle. Levels decrease approximately 10-fold in the secretory phase. Virtually undetectable in samples from postmenopausal women. {ECO:0000269|PubMed:23449591}.
Protein families：Alpha/beta interferon family