CDS2_HUMAN O95674
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95674
Recommended name：Phosphatidate cytidylyltransferase 2
EC number：EC:2.7.7.41
Alternative names：(CDP-DAG synthase 2) (CDP-DG synthase 2) (CDP-diacylglycerol synthase 2) (CDS 2) (CDP-diglyceride pyrophosphorylase 2) (CDP-diglyceride synthase 2) (CTP:phosphatidate cytidylyltransferase 2)
Cleaved into：
GeneID：8760
Gene names (primary )：CDS2
Gene names (synonym )：
Gene names (ORF )：
Length：445
Mass：51418
Sequence：MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE
Tissue specificity：Widely expressed. Expressed in heart, brain and retina, and to a lesser extent in placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:9889000}.
Induction：
Developmental stage：No expression detected at E10.5 in the developing brain. At E12.5 expression is detected in the developing sentral nervous system and peripheral nervous system. At E17.5 high levels of expression are detected in a number of sites, including the dorsal root ganglia of the peripheral nervous system and the ganglion cell layer of the neural retina in the developing eye. At this stage expression in the brain is restricted to the ventricular zone of the telencephalon, in particular in the basal ganglia and the cerebral cortex. {ECO:0000269|PubMed:9889000}.
Protein families：CDS family