CC130_MOUSE   Q9D516


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D516

Recommended name:Coiled-coil domain-containing protein 130

EC number:

Alternative names:

Cleaved into:

GeneID:67736

Gene names  (primary ):Ccdc130

Gene names  (synonym ):

Gene names  (ORF ):

Length:385

Mass:43880

Sequence:MGERKGQNKYYPPDFNPEKHGSLNRYHNSHPLRERARKLSQGILVIRFEMPYNIWCDGCKNHIGMGVRYNAEKKKVGNYYTTPIYRFRMKCHLCVNYIEMQTDPANCDYVIVSGASRKEERWDMEDNEQVLTTEHEKKEKLETDAMFRLEHGEADRSTLKKALPTLSHIQEAQNAWKDDFALNSMLRRHFREKKKAMQEEEEKDQALQAKASLAIPLVPESEDDRRLAALLRLHTLDSYEDKQRMKRTEIIHRSWFPSAQGPSASSSKASSVLKKLCQGRRPPPSSTGTVGDLGIVRRKSRDVPESPQCAADNSLSEEQRRPPGTTQGSKTLEEAAEASRTSKTSESKRNCSDQAFPLGSSQEDLLNPNTPNASLVADYSDSESE

Tissue specificity:

Induction:

Developmental stage:

Protein families:CWC16 family


   💬 WhatsApp