YPEL2_MOUSE   Q65Z95


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q65Z95

Recommended name:Protein yippee-like 2

EC number:

Alternative names:

Cleaved into:

GeneID:77864

Gene names  (primary ):Ypel2

Gene names  (synonym ):

Gene names  (ORF ):

Length:119

Mass:13577

Sequence:MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIELAHMIKDNGWD

Tissue specificity:Detected in testis, heart, brain, spleen, lung and liver. {ECO:0000269|PubMed:15556292}.

Induction:

Developmental stage:

Protein families:Yippee family


   💬 WhatsApp