UEVLD_MOUSE   Q3U1V6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3U1V6

Recommended name:Ubiquitin-conjugating enzyme E2 variant 3

EC number:

Alternative names:(UEV-3) (EV and lactate/malate dehydrogenase domain-containing protein)

Cleaved into:

GeneID:54122

Gene names  (primary ):Uevld

Gene names  (synonym ):Attp Uev3

Gene names  (ORF ):

Length:471

Mass:51681

Sequence:MEFDCEGVRRLLGKYKFRDLTVEELKNVSVSFPHFRYSVDTYVFKDTSQKDLLNFTGTIPVMYQGKTYNIPIRFWILDSHPFAPPICFLKPTANMEISVGKHVDAKGRIYLPYLQNWSHPKSAIVGLIKEMIAKFQEELPLYSIPSSNEAQQVDLLAYITKITEGVSDINSRGWTNHENKILNKITVVGSGDLGIACTLAISAKGIADKLLLLDLSDGMSQGTMDLDIFNLPNVEISKDLSASAHSKVVIFTANSLGGSESYLHAVQSNVDMFRALVPALGHYSQHAVLLVASQPVEIMSYVTWKLSTFPATRVVGIGCNLDSQRLQYIITSVLKVQTSGKEVWVVGEQGENKVCSWSGRDGVLSPSSQAQLSSRAMELLKVKGQRSWSVGLSVADLVDTIINNKRKVHSVSTLAKGYYGLDNEVFLSLPCILGTGGVSEVIKTKAGEDTVTGTLQASASSIHALQQQLEL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ubiquitin-conjugating enzyme family, UEV subfamily; LDH/MDH superfamily