EMC6_MOUSE   Q9CQW0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQW0

Recommended name:ER membrane protein complex subunit 6

EC number:

Alternative names:(Transmembrane protein 93)

Cleaved into:

GeneID:66048

Gene names  (primary ):Emc6

Gene names  (synonym ):Tmem93

Gene names  (ORF ):

Length:110

Mass:12017

Sequence:MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Tissue specificity:

Induction:

Developmental stage:

Protein families:EMC6 family


   💬 WhatsApp