TANK_MOUSE   P70347


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70347

Recommended name:TRAF family member-associated NF-kappa-B activator

EC number:

Alternative names:(TRAF-interacting protein) (I-TRAF)

Cleaved into:

GeneID:21353

Gene names  (primary ):Tank

Gene names  (synonym ):Itraf

Gene names  (ORF ):

Length:448

Mass:50939

Sequence:MSLKRHSLRRNACHLETRAGIPTILYSDATGQRGMDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQTENYEQRIREQQEQLSFQQNLIDRLKSQLLLVDSSRDNSYGYVPLLEDSDRRKNNLTLDEPHDKVKLGTLRDKQSKVRRQEVSSGKESAKGLNIPLHHERDNIEKTFWDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQCTDKTEKQEALFKPQAKDDINRGMSCVTAVTPRGLGRDEEDTSFESLSKFNVKFPPMDNDSIFLHSTPEAPSILAPATPETVCQDRFNMEVRDNPGNFVKTEETLFEIQGIDPITSAIQNLKTTDKTNPSNLRATCLPAGDHNVFYVNTFPLQDPPDAPFPSLDSPGKAVRGPQQPFWKPFLNQDTDLVVPSDSDSELLKPLVCEFCQELFPPSITSRGDFLRHLNTHFNGET

Tissue specificity:Heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp