TNR26_MOUSE P83626
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P83626
Recommended name:Tumor necrosis factor receptor superfamily member 26
EC number:
Alternative names:(TNF receptor homolog 3)
Cleaved into:
GeneID:244237
Gene names (primary ):Tnfrsf26
Gene names (synonym ):Tnfrh3
Gene names (ORF ):
Length:204
Mass:22708
Sequence:MTRLRLLLLLGLLLRVAVCSVNTITLCKIGEFKHENLCCLQCSAGTYLRNPCQENHNKSECAPCDSEHFIDHKNRESECFPCSVCRDDQEEVAKCSRTADRVCQCKQGTYCDSENCLERCHTCSSCPDGRVVRKCNATMDTVCDKFDSEPGQSGSQCFCFSKPLGIVVIIAAFIIIIGAVIILILKIICYCKRGENIQLSSTML
Tissue specificity:Expressed in thymus and spleen. Detectable levels in lung. {ECO:0000269|PubMed:12466268}.
Induction:
Developmental stage:
Protein families: