SPERI_MOUSE Q148B6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q148B6
Recommended name：Speriolin
EC number：
Alternative names：(Spermatogenesis and centriole-associated protein 1) (Spermatogenic cell-specific Cdc20-binding protein)
Cleaved into：
GeneID：74281
Gene names (primary )：Spatc1
Gene names (synonym )：Sprn
Gene names (ORF )：
Length：480
Mass：51418
Sequence：MSLLTSYEGLRHQIERLVRENEELKKLVRLIRENQELKSAIKTQAGGLCISGFTGGLGEAAAGPPQHQGVFLPPASAAAKEPCSEDLGMVALAPLADMLNTPQLSPAAGSLVNPLAATLNPLLSGQIPLLQNNQFANLVPCSMSNQLTNPTTVSPGVTLASSLGLPSTGPLNSQMTSPMTVPPGTTLASSLGLTSTGSLTTSSRLVGPLAVSQSSPIMAPLAGTVAVSLSSPLLSSTATPLGVAQNVVPNPINNIGQPETPRVRRAEPTRGNFSGTSAYAGPAPTSKVNDTRGSRVMEQSRKNVVEMERKTPHRKSNKLPDNPRDTKQLVCERLVGEIAFQLDRRILSSIFPERVRLYGFTVSNIPEKIIQASLNPSNHKLDEDLCQTLTQRYVSIMNKLQSLGYNGRVHPALTEQLVNEYGILRERPELAASEGGCYTVDFLQRVLLETVHPSKLTDALLLLSCLHQLSHDDGKPMFIW
Tissue specificity：Expressed in testis. Expressed in pachyten spermatocytes, spermatids and epididymal sperm (at protein level). {ECO:0000269|PubMed:15280373, ECO:0000269|PubMed:20542897}.
Induction：
Developmental stage：
Protein families：Speriolin family