SI11A_MOUSE   Q99J19


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99J19

Recommended name:Small integral membrane protein 11A

EC number:

Alternative names:(Small integral membrane protein 11)

Cleaved into:

GeneID:68936

Gene names  (primary ):Smim11a

Gene names  (synonym ):Fam165b Smim11

Gene names  (ORF ):

Length:55

Mass:6345

Sequence:MNWKVLEHVPLLLYILAAKTLILCLAFAGVKMYQRRSLEGKLQAEKRKQSEKKAS

Tissue specificity:Expressed in brain, heart, kidney, thymus, liver, stomach, muscle, lung, testis, ovary, skin and eye.

Induction:

Developmental stage:

Protein families:SMIM11 family


   💬 WhatsApp