ECSIT_MOUSE   Q9QZH6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZH6

Recommended name:Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial

EC number:

Alternative names:(Protein SITPEC)

Cleaved into:

GeneID:26940

Gene names  (primary ):Ecsit

Gene names  (synonym ):Sitpec

Gene names  (ORF ):

Length:435

Mass:49799

Sequence:MSWVQVNLLVRSLSRGWGGLCRPALSGTPFAQVSLQALRGLHCSAATHKDEPWLVPRPPEPQRKPIKVPAMHEDLFKPSGNRERDKASFLNAVRSFGAHNVRKRGHVDFIYLALRKMPEFGVERDLSVYNLLLDVFPKEVFRPRNVIQRIFVHYPRQQECGVAVLEQMERHGVMPSAETEFLLIQIFGRKSYPMLKFLRMKLWFTRFKNINPYPVPRDLPQDPLDLAKLGLRHMEPDLSAKVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGPFPLWLRNKCVYYHILRADLPPPEEEKVEEIPEEWELYYPQKLDLEYSRSGWDDYEFDVDEVTEGPVFAMCMAGAHDQATLIKWIQGLQETNPTLAQIPVVFRLARSTGELLTTSRLEGQSPPHSPPKGPEEDDETIQAEQQQGQS

Tissue specificity:Detected in heart, brain, lung, liver, skeletal muscle, kidney and testis. Detected in embryonic mesoderm and epiblast, and in extraembryonic ectoderm. {ECO:0000269|PubMed:10465784, ECO:0000269|PubMed:14633973}.

Induction:

Developmental stage:

Protein families:ECSIT family


   💬 WhatsApp