PP1R7_MOUSE Q3UM45
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UM45
Recommended name：Protein phosphatase 1 regulatory subunit 7
EC number：
Alternative names：(Protein phosphatase 1 regulatory subunit 22)
Cleaved into：
GeneID：66385
Gene names (primary )：Ppp1r7
Gene names (synonym )：Sds22
Gene names (ORF )：
Length：361
Mass：41292
Sequence：MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHGGGGIVANLSEQSLKDGVDRGAEDPEEEHELAVDMETINLDRDAEDVDLTHYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATYVRF
Tissue specificity：Widely expressed with high level in testis. Expression increases during puberty. Expressed in spermatids and probably also in spermatozoa. {ECO:0000269|PubMed:12972598}.
Induction：
Developmental stage：
Protein families：SDS22 family