O1537_MOUSE P34983
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P34983
Recommended name:Olfactory receptor 1537
EC number:
Alternative names:(Odorant receptor K4) (Olfactory receptor 144) (Olfactory receptor 7B)
Cleaved into:
GeneID:257959
Gene names (primary ):Olfr1537
Gene names (synonym ):Olfr144 Olfr7
Gene names (ORF ):
Length:314
Mass:35267
Sequence:MEDMAAGNHCTVTEFFLAGLSEKPELQLPLFLLFTGIYLITMAGNLGMITLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVIPKMLVSFLTEMNIISYSECMAQLYFFLTFGIAECYTLAAMAYDRYVAICNPLLYNVTMSYQIYSSLISGVYIFAVICSSFNTGFMLRTQFCNLDVINHYFCDLLPLLNLASSNTYINEILILFFATLNSFVPVLTIITSYIFIIVTILSIHSREGKFKAFSTCSTHISAVAIFYGSGAFTYLQPSSLNSMGQAKVSSVFYTTVVPMLNPLIYSLRNKDVSIALKKILERKKFM
Tissue specificity:
Induction:
Developmental stage:
Protein families:G-protein coupled receptor 1 family