SOSB2_MOUSE   Q8BGW5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BGW5

Recommended name:SOSS complex subunit B2

EC number:

Alternative names:(Nucleic acid-binding protein 1) (Oligonucleotide/oligosaccharide-binding fold-containing protein 2A) (Sensor of single-strand DNA complex subunit B2) (Sensor of ssDNA subunit B2) (SOSS-B2) (Single-stranded DNA-binding protein 2)

Cleaved into:

GeneID:109019

Gene names  (primary ):Nabp1

Gene names  (synonym ):Obfc2a Ssb2

Gene names  (ORF ):

Length:198

Mass:21749

Sequence:MHGVNDPPLFIKDIKAGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADRTGSITISVWDEIGGLIQTGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNRGVQNEQKDKLSTNTFGPVGNGDQTGPESRGYHLPYGRSNGPGPISPQLPGTPSSQTVRTTISNARDPRRAFKR

Tissue specificity:Ubiquitous with high expression in the thymus. {ECO:0000269|PubMed:16533169}.

Induction:

Developmental stage:

Protein families:SOSS-B family, SOSS-B2 subfamily


   💬 WhatsApp