NDKB_MOUSE   Q01768


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q01768

Recommended name:Nucleoside diphosphate kinase B

EC number:EC 2.7.4.6

Alternative names:(NDK B) (NDP kinase B) (Histidine protein kinase NDKB) (P18) (nm23-M2)

Cleaved into:

GeneID:18103

Gene names  (primary ):Nme2

Gene names  (synonym ):

Gene names  (ORF ):

Length:152

Mass:17363

Sequence:MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIHLWFKPEELIDYKSCAHDWVYE

Tissue specificity:Expressed in the base region of the oxyntic and pyloric mucosae. {ECO:0000269|PubMed:16476741}.

Induction:

Developmental stage:

Protein families:NDK family


   💬 WhatsApp