AADAT_MOUSE   Q9WVM8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WVM8

Recommended name:Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial

EC number:EC 2.6.1.39

Alternative names:(KAT/AadAT) (2-aminoadipate aminotransferase) (2-aminoadipate transaminase) (Alpha-aminoadipate aminotransferase) (AadAT) (Kynurenine aminotransferase II) (Kynurenine--oxoglutarate aminotransferase II) (Kynurenine--oxoglutarate transaminase 2) (Kynurenine--oxoglutarate transaminase II)

Cleaved into:

GeneID:23923

Gene names  (primary ):Aadat

Gene names  (synonym ):Kat2

Gene names  (ORF ):

Length:425

Mass:47598

Sequence:MNYSRFLTATSLARKPSPIRTTADILSKAPKTLISLAPGSPNPSMFPFKSAAFTVENGSTIRFEDDLIKRALQYSPSYGIPELLSWLKQFQVKLHNPPTVNYPPNQGQMDLCITSGCQDGLCKAFEMLINPGDTILVNEPLFPGTLYAMKPLGCNIINVPSDEHGIIPEGLKKILSQWKPEDSKDPTKKTPKFLYTVPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFSKPWEPTFLSMDVDGRVIRADTFSKTVSSGLRVGFMTGPKTLIQNIVLHTQVSSVHACTLSQLMILQLLHQWGEEGFLAHIDRTIDFYKNQRDSILAAADKWLRGLAEWHVPKAGMFLWIKVKGISDTKQLIEEKAIEREVLLVPGNGFFIDGSAPTSFFRASFSLATPAQMDTAFQRLAQLIKESL

Tissue specificity:Expressed mainly in kidney and to a lesser amount in liver and brain. {ECO:0000269|PubMed:10441733}.

Induction:

Developmental stage:

Protein families:Class-I pyridoxal-phosphate-dependent aminotransferase family


   💬 WhatsApp