ADM2_MOUSE Q7TNK8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TNK8
Recommended name：Protein ADM2
EC number：
Alternative names：(Intermedin)
Cleaved into：Adrenomedullin-2 (AM2) (Intermedin-long) (IMDL); Intermedin-short (IMDS)
GeneID：223780
Gene names (primary )：Adm2
Gene names (synonym )：Am2
Gene names (ORF )：
Length：150
Mass：16188
Sequence：MAQLLMVTVTLGCISLLYLLPGTLSGSLGKGLRHSRPREPPAKIPSSNLQPGHPSLQPVVWKSRRHAPQPQGRGNRALAMVHLPQGGGSRHPGPQRPTGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSYG
Tissue specificity：High expression detected in the submaxillary gland, kidney, stomach, and mesentery, followed by the pituitary, lung, pancreas, intestines, spleen, thymus and ovary. Expressed mainly in the intermediate lobe of the pituitary, with sporadic in the anterior lobe. {ECO:0000269|PubMed:14615490, ECO:0000269|PubMed:14706825}.
Induction：
Developmental stage：
Protein families：Adrenomedullin family