HEAT9_MOUSE   Q5QNV8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5QNV8

Recommended name:Protein HEATR9

EC number:

Alternative names:(HEAT repeat-containing protein 9)

Cleaved into:

GeneID:629303

Gene names  (primary ):Heatr9

Gene names  (synonym ):Gm11435

Gene names  (ORF ):

Length:569

Mass:65861

Sequence:MESQEKQADFFQIPKSMDYRNRNKKFRKAMAPVHLPLSCYKVPKEAFPPSPECWRVHPSRPNATPCLHLDKKPDLFTHWRTLNEQRKERESKSLFWKRRNFPRYFKDSAQMPNLHVSISKLTLKPKEGPGLLDPTKDPLKWQRLKELTNGLNSPQEDEQCYAAYALGHLGISNKFVMEALWQVAQTGSTKVKNEAYKSLASLGCLDKSVIKAFIKQLMEHKESQRLETLVGLRVALNSWAAMPKNKKPEVPYEEKLVLLLQNLIYKPLNEESLEAALCLGFLRPSNSIVQQFLLQCLSKGSMSQRMKALRMLVKMMNVHSAAVTRAILEQLHSNVIDDRLEATQMLKTVGLEKIQAQGLVKLTFDLLKRKMYSEPFQVIRQAVSETVDVLKMKPLIMKLMEAQLMSPDVSDRQEAIISLGALGIRNEKVFHLLLDMLDAEETKSVKKSIQETLLVWASRNPWIQNKLTNKVFFVYDIPKAVKTEHTRFRKKPESPDDLCITDFRRAKLNPLFITKAYNKLGEKLEAPAFSFYFSKPKKQRPQATGPWEPKIREQLRNMVLPQNRFLFWL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp